PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3678s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family WRKY
Protein Properties Length: 186aa    MW: 21123.6 Da    PI: 9.8691
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3678s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.4e-32106164159
                             ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                    WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                             ldDgy+WrKYGqK vk+++fprsYYrCt++gC vkk+v+r ++d+ vv++tYeg H+h+
  SapurV1A.3678s0020.1.p 106 LDDGYRWRKYGQKAVKNNRFPRSYYRCTYQGCDVKKQVQRLTKDEGVVVTTYEGMHTHP 164
                             59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-3391164IPR003657WRKY domain
SuperFamilySSF1182901.57E-2998165IPR003657WRKY domain
PROSITE profilePS5081129.689101166IPR003657WRKY domain
SMARTSM007743.7E-38106165IPR003657WRKY domain
PfamPF031062.0E-26107164IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MEKFQMLFPF SSTGSSNYPV SSSMTDSSHV FHNFQADNSG GFLGLKTENH HPVPRTSPES  60
NKDLNSQSSS LAIGSGTEPQ AAKKKGEKKI RKPKYAFQTR SQVDILDDGY RWRKYGQKAV  120
KNNRFPRSYY RCTYQGCDVK KQVQRLTKDE GVVVTTYEGM HTHPIEKPND NFEHILSQMQ  180
VYTPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2796165776Probable WRKY transcription factor 4
2lex_A2e-2796165776Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300120.21e-119hypothetical protein POPTR_0001s33560g
RefseqXP_011000970.11e-119PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA26e-56WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9GF441e-119B9GF44_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33560.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-56WRKY DNA-binding protein 75